SCOPe 2.08: Domain d3ljdb_: 3ljd B:

Lineage for d3ljdb_ (3ljd B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (7 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188473] (5 PDB entries)

8. Domain d3ljdb_: 3ljd B: [180321]
   automated match to d1k58a_
   complexed with act, so4

Details for d3ljdb_

PDB Entry: 3ljd, 1.38 Å

PDB Description: the x-ray structure of zebrafish rnase1 from a new crystal form at ph 4.5

PDB Compounds: (B:) Zebrafish RNase1

SCOPe Domain Sequences for d3ljdb_:

Sequence; same for both SEQRES and ATOM records:

>d3ljdb_ d.5.1.0 (B:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
mhvkeryknflnqhvgpdmsvqrcnseigpnnrkitlsgtdngckpvntfilankrlikt
vcgragspqgnmvrsnqpfpvvkcvlnngerhpyceyrgtrstryivlkceegwpvhyhe
devnvg

Timeline for d3ljdb_:

• d3ljdb_ first appeared in SCOPe 2.01
  
• d3ljdb_ appears in SCOPe 2.07