| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein Macrophage elastase (MMP-12) [69780] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries) Uniprot P39900 106-263 ! Uniprot P39900 106-264 |
| Domain d3lila1: 3lil A:106-263 [180312] Other proteins in same PDB: d3lila2 automated match to d1os2a_ complexed with ca, eea, hae, zn |
PDB Entry: 3lil (more details), 1.8 Å
SCOPe Domain Sequences for d3lila1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lila1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg
Timeline for d3lila1: