SCOPe 2.08: Domain d3lila1: 3lil A:106-263

Lineage for d3lila1 (3lil A:106-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d3lila1: 3lil A:106-263 [180312]
   Other proteins in same PDB: d3lila2
   automated match to d1os2a_
   complexed with ca, eea, hae, zn

Details for d3lila1

PDB Entry: 3lil, 1.8 Å

PDB Description: human mmp12 in complex with non-zinc chelating inhibitor

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3lila1:

Sequence; same for both SEQRES and ATOM records:

>d3lila1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d3lila1:

• d3lila1 first appeared in SCOPe 2.01, called d3lila_
  
• d3lila1 appears in SCOPe 2.07