Lineage for d3li5a_ (3li5 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802809Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 1802810Family b.68.6.1: SGL-like [63830] (4 proteins)
  6. 1802841Protein automated matches [190602] (2 species)
    not a true protein
  7. 1802842Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries)
  8. 1802843Domain d3li5a_: 3li5 A: [180310]
    automated match to d1pjxa_
    complexed with ca, mes; mutant

Details for d3li5a_

PDB Entry: 3li5 (more details), 1.36 Å

PDB Description: diisopropyl fluorophosphatase (dfpase), e21q,n120d,n175d,d229n mutant
PDB Compounds: (A:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d3li5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3li5a_ b.68.6.1 (A:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
ipvieplftkvtedipgaqgpvfdkngdfyivapevevngkpageilridlktgkktvic
kpevngyggipagcqcdrdanqlfvadmrlgllvvqtdgtfeeiakkdsegrrmqgcddc
afdyegnlwitapagevapadytrsmqekfgsiycfttdgqmiqvdtafqfpdgiavrhm
ndgrpyqlivaetptkklwsydikgpakienkkvwghipgtheggangmdfdednnllva
nwgsshievfgpdggqpkmrircpfekpsnlhfkpqtktifvtehennavwkfewqrngk
kqycetlkfgif

SCOPe Domain Coordinates for d3li5a_:

Click to download the PDB-style file with coordinates for d3li5a_.
(The format of our PDB-style files is described here.)

Timeline for d3li5a_: