Lineage for d3li4a_ (3li4 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065620Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2065621Family b.68.6.1: SGL-like [63830] (4 protein domains)
  6. 2065622Protein Diisopropylfluorophosphatase (phosphotriesterase, DFP) [63831] (1 species)
  7. 2065623Species Squid (Loligo vulgaris) [TaxId:6622] [63832] (21 PDB entries)
    Uniprot Q7SIG4
  8. 2065628Domain d3li4a_: 3li4 A: [180309]
    automated match to d1pjxa_
    complexed with ca; mutant

Details for d3li4a_

PDB Entry: 3li4 (more details), 1.35 Å

PDB Description: Diisopropyl fluorophosphatase (DFPase), N120D,N175D,D229N mutant
PDB Compounds: (A:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d3li4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3li4a_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}
ipvieplftkvtedipgaegpvfdkngdfyivapevevngkpageilridlktgkktvic
kpevngyggipagcqcdrdanqlfvadmrlgllvvqtdgtfeeiakkdsegrrmqgcddc
afdyegnlwitapagevapadytrsmqekfgsiycfttdgqmiqvdtafqfpdgiavrhm
ndgrpyqlivaetptkklwsydikgpakienkkvwghipgtheggangmdfdednnllva
nwgsshievfgpdggqpkmrircpfekpsnlhfkpqtktifvtehennavwkfewqrngk
kqycetlkfgif

SCOPe Domain Coordinates for d3li4a_:

Click to download the PDB-style file with coordinates for d3li4a_.
(The format of our PDB-style files is described here.)

Timeline for d3li4a_: