| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (2 proteins) |
| Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
| Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries) |
| Domain d9icha1: 9ich A:9-91 [18029] Other proteins in same PDB: d9icha3, d9icha4 protein/DNA complex; complexed with dgt, na, zn |
PDB Entry: 9ich (more details), 2.9 Å
SCOP Domain Sequences for d9icha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d9icha1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd
Timeline for d9icha1: