Lineage for d3lhrb1 (3lhr B:3-93)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706569Species Human (Homo sapiens) [TaxId:9606] [189328] (2 PDB entries)
  8. 2706571Domain d3lhrb1: 3lhr B:3-93 [180289]
    Other proteins in same PDB: d3lhra2, d3lhrb2
    automated match to d1y7qa1
    complexed with cl, emc, mg, peg

Details for d3lhrb1

PDB Entry: 3lhr (more details), 1.9 Å

PDB Description: crystal structure of the scan domain from human znf24
PDB Compounds: (B:) Zinc finger protein 24

SCOPe Domain Sequences for d3lhrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lhrb1 a.28.3.0 (B:3-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdpeifrqrfrqfgyqdspgpreavsqlrelcrlwlrpethtkeqilelvvleqfvailp
kelqtwvrdhhpengeeavtvledleseldd

SCOPe Domain Coordinates for d3lhrb1:

Click to download the PDB-style file with coordinates for d3lhrb1.
(The format of our PDB-style files is described here.)

Timeline for d3lhrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lhrb2