SCOPe 2.08: Domain d3lhrb1: 3lhr B:3-93

Lineage for d3lhrb1 (3lhr B:3-93)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189328] (2 PDB entries)

8. Domain d3lhrb1: 3lhr B:3-93 [180289]
   Other proteins in same PDB: d3lhra2, d3lhrb2
   automated match to d1y7qa1
   complexed with cl, emc, mg, peg

Details for d3lhrb1

PDB Entry: 3lhr, 1.9 Å

PDB Description: crystal structure of the scan domain from human znf24

PDB Compounds: (B:) Zinc finger protein 24

SCOPe Domain Sequences for d3lhrb1:

Sequence; same for both SEQRES and ATOM records:

>d3lhrb1 a.28.3.0 (B:3-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdpeifrqrfrqfgyqdspgpreavsqlrelcrlwlrpethtkeqilelvvleqfvailp
kelqtwvrdhhpengeeavtvledleseldd

Timeline for d3lhrb1:

• d3lhrb1 first appeared in SCOPe 2.01, called d3lhrb_
  
• d3lhrb1 appears in SCOPe 2.07