| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
| Protein automated matches [191156] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189328] (2 PDB entries) |
| Domain d3lhra_: 3lhr A: [180288] automated match to d1y7qa1 complexed with cl, emc, mg, peg |
PDB Entry: 3lhr (more details), 1.9 Å
SCOPe Domain Sequences for d3lhra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lhra_ a.28.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gspdpeifrqrfrqfgyqdspgpreavsqlrelcrlwlrpethtkeqilelvvleqfvai
lpkelqtwvrdhhpengeeavtvledleseld
Timeline for d3lhra_: