SCOPe 2.08: Domain d3lhea_: 3lhe A:

Lineage for d3lhea_ (3lhe A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (4 families)

5. Family d.190.1.0: automated matches [191611] (1 protein)
   not a true family

6. Protein automated matches [191116] (5 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:260799] [189233] (1 PDB entry)

8. Domain d3lhea_: 3lhe A: [180286]
   automated match to d3ddva1
   complexed with cl, gol

Details for d3lhea_

PDB Entry: 3lhe, 1.62 Å

PDB Description: The crystal structure of the C-terminal domain of a GntR family transcriptional regulator from Bacillus anthracis str. Sterne

PDB Compounds: (A:) GntR family Transcriptional regulator

SCOPe Domain Sequences for d3lhea_:

Sequence, based on SEQRES records:

>d3lhea_ d.190.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 260799]}
vygseveskiieftivgadeiiaeklgisvgdfvykiirlriihsiptimehtwmpisvi
pgvevsvleesiyshiqnklglqvgtsvvrvkgirpddkekqfmnltnqdflmrveqvay
ltdgrtfeysyadhlpetf

Sequence, based on observed residues (ATOM records):

>d3lhea_ d.190.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 260799]}
vygseveskiieftivgadeiiaeklgisvgdfvykiirlriihsiptimehtwmpisvi
pgvelglqvgtsvvrvkgirpddkekqfmnltnqdflmrveqvayltdgrtfeysyadhl
petf

Timeline for d3lhea_:

• d3lhea_ first appeared in SCOPe 2.01
  
• d3lhea_ appears in SCOPe 2.07