SCOPe 2.07: Domain d3lgmb1: 3lgm B:1-108

Lineage for d3lgmb1 (3lgm B:1-108)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (6 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein PG130 (SAV0165) [110955] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110956] (7 PDB entries)
   Uniprot Q99X56

8. Domain d3lgmb1: 3lgm B:1-108 [180279]
   Other proteins in same PDB: d3lgma2, d3lgmb2
   automated match to d1sqea_
   complexed with hem, mg

Details for d3lgmb1

PDB Entry: 3lgm

PDB Description: Crystal structure of reduced IsdI in complex with heme

PDB Compounds: (B:) Heme-degrading monooxygenase isdI

SCOPe Domain Sequences for d3lgmb1:

Sequence; same for both SEQRES and ATOM records:

>d3lgmb1 d.58.4.5 (B:1-108) Hypothetical protein PG130 (SAV0165) {Staphylococcus aureus [TaxId: 1280]}
mfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwese
dsfnnwlnsdvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk

Timeline for d3lgmb1:

• d3lgmb1 first appeared in SCOPe 2.01, called d3lgmb_
  
• d3lgmb1 appears in SCOPe 2.06
  
• d3lgmb1 appears in the current release, SCOPe 2.08