| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.2: t-snare proteins [47661] (1 family) ![]() |
| Family a.47.2.1: t-snare proteins [47662] (6 proteins) |
| Protein automated matches [191190] (5 species) not a true protein |
| Species Artificial gene [TaxId:32630] [189472] (1 PDB entry) |
| Domain d3lg7c1: 3lg7 C:1-124 [180273] Other proteins in same PDB: d3lg7a2, d3lg7b2, d3lg7c2 automated match to d1ez3a_ complexed with so4 |
PDB Entry: 3lg7 (more details), 2.5 Å
SCOPe Domain Sequences for d3lg7c1:
Sequence, based on SEQRES records: (download)
>d3lg7c1 a.47.2.1 (C:1-124) automated matches {Artificial gene [TaxId: 32630]}
rdkfmdeffkqveeirqyidriaenveevarqhqailaspnpnwfdisqllwlmadiket
anevrkklkeieqsieqeegknkssadlkirkrqheelerkfrevmkeynatqqdyrkra
rkrn
>d3lg7c1 a.47.2.1 (C:1-124) automated matches {Artificial gene [TaxId: 32630]}
rdkfmdeffkqveeirqyidriaenveevarqhqailaspnpnwfdisqllwlmadiket
anevrkklkeieqsieqeessadlkirkrqheelerkfrevmkeynatqqdyrkrarkrn
Timeline for d3lg7c1:
View in 3DDomains from other chains: (mouse over for more information) d3lg7a1, d3lg7a2, d3lg7b1, d3lg7b2 |