![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
![]() | Superfamily a.47.2: t-snare proteins [47661] (1 family) ![]() |
![]() | Family a.47.2.1: t-snare proteins [47662] (6 proteins) |
![]() | Protein automated matches [191190] (5 species) not a true protein |
![]() | Species Artificial gene [TaxId:32630] [189472] (1 PDB entry) |
![]() | Domain d3lg7b1: 3lg7 B:0-124 [180272] Other proteins in same PDB: d3lg7a2, d3lg7b2, d3lg7c2 automated match to d1ez3a_ complexed with so4 |
PDB Entry: 3lg7 (more details), 2.5 Å
SCOPe Domain Sequences for d3lg7b1:
Sequence, based on SEQRES records: (download)
>d3lg7b1 a.47.2.1 (B:0-124) automated matches {Artificial gene [TaxId: 32630]} mrdkfmdeffkqveeirqyidriaenveevarqhqailaspnpnwfdisqllwlmadike tanevrkklkeieqsieqeegknkssadlkirkrqheelerkfrevmkeynatqqdyrkr arkrn
>d3lg7b1 a.47.2.1 (B:0-124) automated matches {Artificial gene [TaxId: 32630]} mrdkfmdeffkqveeirqyidriaenveevarqhqailaspnpnwfdisqllwlmadike tanevrkklkeieqsieqeekssadlkirkrqheelerkfrevmkeynatqqdyrkrark rn
Timeline for d3lg7b1:
![]() Domains from other chains: (mouse over for more information) d3lg7a1, d3lg7a2, d3lg7c1, d3lg7c2 |