Lineage for d3lg7b1 (3lg7 B:0-124)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714459Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2714477Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 2714478Family a.47.2.1: t-snare proteins [47662] (6 proteins)
  6. 2714502Protein automated matches [191190] (5 species)
    not a true protein
  7. 2714503Species Artificial gene [TaxId:32630] [189472] (1 PDB entry)
  8. 2714505Domain d3lg7b1: 3lg7 B:0-124 [180272]
    Other proteins in same PDB: d3lg7a2, d3lg7b2, d3lg7c2
    automated match to d1ez3a_
    complexed with so4

Details for d3lg7b1

PDB Entry: 3lg7 (more details), 2.5 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_S0_1EZ3A_002_C
PDB Compounds: (B:) 4e10_s0_1ez3a_002_c (t246)

SCOPe Domain Sequences for d3lg7b1:

Sequence, based on SEQRES records: (download)

>d3lg7b1 a.47.2.1 (B:0-124) automated matches {Artificial gene [TaxId: 32630]}
mrdkfmdeffkqveeirqyidriaenveevarqhqailaspnpnwfdisqllwlmadike
tanevrkklkeieqsieqeegknkssadlkirkrqheelerkfrevmkeynatqqdyrkr
arkrn

Sequence, based on observed residues (ATOM records): (download)

>d3lg7b1 a.47.2.1 (B:0-124) automated matches {Artificial gene [TaxId: 32630]}
mrdkfmdeffkqveeirqyidriaenveevarqhqailaspnpnwfdisqllwlmadike
tanevrkklkeieqsieqeekssadlkirkrqheelerkfrevmkeynatqqdyrkrark
rn

SCOPe Domain Coordinates for d3lg7b1:

Click to download the PDB-style file with coordinates for d3lg7b1.
(The format of our PDB-style files is described here.)

Timeline for d3lg7b1: