SCOP 1.57: Domain d9icfa1: 9icf A:9-91

Lineage for d9icfa1 (9icf A:9-91)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.60: SAM domain-like [47768] (10 superfamilies)

4. Superfamily a.60.6: DNA polymerase beta, N-terminal (8 kD)-domain [47802] (1 family)

5. Family a.60.6.1: DNA polymerase beta, N-terminal (8 kD)-domain [47803] (1 protein)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (90 PDB entries)

8. Domain d9icfa1: 9icf A:9-91 [18027]
   Other proteins in same PDB: d9icfa2

Details for d9icfa1

PDB Entry: 9icf, 3 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2'-deoxyadenosine-5'-triphosphate, soaked in the presence of datp and zncl2

SCOP Domain Sequences for d9icfa1:

Sequence; same for both SEQRES and ATOM records:

>d9icfa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

Timeline for d9icfa1:

• d9icfa1 first appeared (with stable ids) in SCOP 1.55
  
• d9icfa1 appears in SCOP 1.59
  
• d9icfa1 appears in the current release, SCOPe 2.08