Lineage for d3lg3a_ (3lg3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838112Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 2838206Protein automated matches [190974] (9 species)
    not a true protein
  7. 2838264Species Yersinia pestis [TaxId:632] [189309] (1 PDB entry)
  8. 2838265Domain d3lg3a_: 3lg3 A: [180269]
    automated match to d1igwa_

Details for d3lg3a_

PDB Entry: 3lg3 (more details), 1.4 Å

PDB Description: 1.4A Crystal Structure of Isocitrate Lyase from Yersinia pestis CO92
PDB Compounds: (A:) isocitrate lyase

SCOPe Domain Sequences for d3lg3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lg3a_ c.1.12.7 (A:) automated matches {Yersinia pestis [TaxId: 632]}
mtisrtqqiqqleqewtsprwknitrpysaedviklrgsvnpectfaqngakklwellhg
gsrkgyinclgaltggqalqqakagveaiymsgwqvaadantassmypdqslypvdsvpa
vvkrinnsfrradqiqwsnniepgskgytdyflpivadaeagfggvlnafelmkamieag
aagvhfedqlaavkkcghmggkvlvptqeaiqklvaarlaadvlgvptlliartdadaad
lltsdcdpydrefitgdrtaegffrtragieqaisrglayapyadlvwcetstpdlalak
rfadavhaqfpgkllayncspsfnwkknltdqqiasfqdelsamgykyqfitlagihsmw
fnmfdlahayaqgegmkhyvekvqqpefasvdrgytfashqqevgtgyfdkvtniiqgg

SCOPe Domain Coordinates for d3lg3a_:

Click to download the PDB-style file with coordinates for d3lg3a_.
(The format of our PDB-style files is described here.)

Timeline for d3lg3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3lg3b_