Lineage for d3lg0b_ (3lg0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131840Protein Ornithine aminotransferase [53422] (3 species)
  7. 2131858Species Plasmodium falciparum [TaxId:5836] [189413] (1 PDB entry)
  8. 2131860Domain d3lg0b_: 3lg0 B: [180266]
    automated match to d1z7da1

Details for d3lg0b_

PDB Entry: 3lg0 (more details), 2.3 Å

PDB Description: Structure of Plasmodium falciparum ornithine delta-aminotransferase
PDB Compounds: (B:) ornithine aminotransferase

SCOPe Domain Sequences for d3lg0b_:

Sequence, based on SEQRES records: (download)

>d3lg0b_ c.67.1.4 (B:) Ornithine aminotransferase {Plasmodium falciparum [TaxId: 5836]}
kssqdymnneltygahnydpipvvlkrgkgvfvydiedrryydflsayssvnqghchpdi
lnaminqakklticsraffsdslgvceryltnlfgydkvlmmntgaeasetayklcrkwg
yevkkipensakiivcnnnfsgrtlgcvsastdkkcknnfgpfvpnflkvpyddlealek
elqdpnvcafivepvqgeagvivpsdsyfpgvaslckkynvlfvadevqtglgrtgkllc
thhygvkpdvillgkalsgghypisailanddvmlvlkpgehgstyggnplaaaicveal
kvlineklcenadklgapflqnlkeqlkdskvvrevrgkgllcaiefkndlvnvwdiclk
fkenglitrsvhdktvrltpplcitkeqldecteiivktvkffddnl

Sequence, based on observed residues (ATOM records): (download)

>d3lg0b_ c.67.1.4 (B:) Ornithine aminotransferase {Plasmodium falciparum [TaxId: 5836]}
kssqdymnneltygahnydpipvvlkrgkgvfvydiedrryydflsayssvnqghchpdi
lnaminqakklticsraffsdslgvceryltnlfgydkvlmmntgaeasetayklcrkwg
yevkkipensakiivcnnnffvpnflkvpyddlealekelqdpnvcafivepvqgeagvi
vpsdsyfpgvaslckkynvlfvadevqtglgrtgkllcthhygvkpdvillgkalsgghy
pisailanddvmlvlkpgehgstyggnplaaaicvealkvlineklcenadklgapflqn
lkeqlkdskvvrevrgkgllcaiefkndlvnvwdiclkfkenglitrsvhdktvrltppl
citkeqldecteiivktvkffddnl

SCOPe Domain Coordinates for d3lg0b_:

Click to download the PDB-style file with coordinates for d3lg0b_.
(The format of our PDB-style files is described here.)

Timeline for d3lg0b_: