| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
| Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
| Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries) |
| Domain d9icaa1: 9ica A:9-91 [18026] Other proteins in same PDB: d9icaa3, d9icaa4 protein/DNA complex; complexed with mn, stp |
PDB Entry: 9ica (more details), 3 Å
SCOP Domain Sequences for d9icaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d9icaa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd
Timeline for d9icaa1: