|  | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) | 
|  | Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily) beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing | 
|  | Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families)  | 
|  | Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins) automatically mapped to Pfam PF00359 | 
|  | Protein automated matches [191189] (2 species) not a true protein | 
|  | Species Artificial gene [TaxId:32630] [189471] (2 PDB entries) | 
|  | Domain d3lf6a_: 3lf6 A: [180244] Other proteins in same PDB: d3lf6b2 automated match to d1xiza_ complexed with po4 | 
PDB Entry: 3lf6 (more details), 1.9 Å
SCOPe Domain Sequences for d3lf6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lf6a_ d.112.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]}
namqgihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv
epvgvaiphtdskyvrqnaisvgilaepvnfedaggepdpvpvrvvfmlalgnwfditnv
lwwimdviqdedfmqqllvmnddeiyqsiytris
Timeline for d3lf6a_: