Lineage for d3lf6a_ (3lf6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971248Fold d.112: Phoshotransferase/anion transport protein [55803] (1 superfamily)
    beta-alpha(2)-beta(3)-alpha(3); 3 layers, alpha/beta/alpha; mixed sheet: order 1342; loop crossing
  4. 2971249Superfamily d.112.1: Phoshotransferase/anion transport protein [55804] (3 families) (S)
  5. 2971250Family d.112.1.1: IIA domain of mannitol-specific and ntr phosphotransferase EII [55805] (4 proteins)
    automatically mapped to Pfam PF00359
  6. 2971267Protein automated matches [191189] (2 species)
    not a true protein
  7. 2971268Species Artificial gene [TaxId:32630] [189471] (2 PDB entries)
  8. 2971269Domain d3lf6a_: 3lf6 A: [180244]
    Other proteins in same PDB: d3lf6b2
    automated match to d1xiza_
    complexed with po4

Details for d3lf6a_

PDB Entry: 3lf6 (more details), 1.9 Å

PDB Description: Crystal structure of HIV epitope-scaffold 4E10_1XIZA_S0_001_N
PDB Compounds: (A:) Putative phosphotransferase system

SCOPe Domain Sequences for d3lf6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lf6a_ d.112.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]}
namqgihfrrhyvrhlpkevsqndiikalasplindgmvvsdfadhvitreqnfptglpv
epvgvaiphtdskyvrqnaisvgilaepvnfedaggepdpvpvrvvfmlalgnwfditnv
lwwimdviqdedfmqqllvmnddeiyqsiytris

SCOPe Domain Coordinates for d3lf6a_:

Click to download the PDB-style file with coordinates for d3lf6a_.
(The format of our PDB-style files is described here.)

Timeline for d3lf6a_: