SCOPe 2.05: Domain d3lf3a_: 3lf3 A:

Lineage for d3lf3a_ (3lf3 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries)

8. Domain d3lf3a_: 3lf3 A: [180243]
   automated match to d1g7ka_

Details for d3lf3a_

PDB Entry: 3lf3, 1.15 Å

PDB Description: crystal structure of fast fluorescent timer fast-ft

PDB Compounds: (A:) Fast Fluorescent Timer Fast-FT

SCOPe Domain Sequences for d3lf3a_:

Sequence; same for both SEQRES and ATOM records:

>d3lf3a_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
nmaiikefmrfkvhvegsvnghefeiegegkgrpyegtqtaklkvtkggplpfawdilsp
qfmygsrayvkhpadipdywklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvk
lrgtnfpsdgpvmqkktmgweastermypedgalkgeikqrlklkdgghydaevkttyka
kkpvqlpgaynvniklditshnedytiveqyersegrhstg

Timeline for d3lf3a_:

• d3lf3a_ first appeared in SCOPe 2.01
  
• d3lf3a_ appears in SCOPe 2.04
  
• d3lf3a_ appears in SCOPe 2.06
  
• d3lf3a_ appears in the current release, SCOPe 2.08