SCOPe 2.01: Domain d3lf0b_: 3lf0 B:

Lineage for d3lf0b_ (3lf0 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189389] (1 PDB entry)

8. Domain d3lf0b_: 3lf0 B: [180241]
   automated match to d1hwua_
   complexed with atp

Details for d3lf0b_

PDB Entry: 3lf0, 2.4 Å

PDB Description: Crystal structure of the ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein

PDB Compounds: (B:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d3lf0b_:

Sequence, based on SEQRES records:

>d3lf0b_ d.58.5.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
hmklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpkv
rievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal

Sequence, based on observed residues (ATOM records):

>d3lf0b_ d.58.5.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
hmklitaivkpftlddvktsledagvlgmtvseiqgygrqghtevyrgaeysvdfvpkvr
ievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal

Timeline for d3lf0b_:

• d3lf0b_ is new in SCOPe 2.01-stable
  
• d3lf0b_ appears in SCOPe 2.02
  
• d3lf0b_ appears in the current release, SCOPe 2.08, called d3lf0b1