SCOPe 2.08: Domain d3lf0a1: 3lf0 A:1-112

Lineage for d3lf0a1 (3lf0 A:1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (7 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189389] (1 PDB entry)

8. Domain d3lf0a1: 3lf0 A:1-112 [180240]
   Other proteins in same PDB: d3lf0a2, d3lf0b2, d3lf0c2
   automated match to d1hwua_
   complexed with atp

Details for d3lf0a1

PDB Entry: 3lf0, 2.4 Å

PDB Description: Crystal structure of the ATP bound Mycobacterium tuberculosis nitrogen regulatory PII protein

PDB Compounds: (A:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d3lf0a1:

Sequence, based on SEQRES records:

>d3lf0a1 d.58.5.1 (A:1-112) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mklitaivkpftlddvktsledagvlgmtvseiqgygrqkghtevyrgaeysvdfvpkvr
ievvvddsivdkvvdsivraartgkigdgkvwvspvdtivrvrtgerghdal

Sequence, based on observed residues (ATOM records):

>d3lf0a1 d.58.5.1 (A:1-112) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mklitaivkpftlddvktsledagvlgmtvseiqgygrdfvpkvrievvvddsivdkvvd
sivraartgkigdgkvwvspvdtivrvrtgerghdal

Timeline for d3lf0a1:

• d3lf0a1 first appeared in SCOPe 2.01, called d3lf0a_
  
• d3lf0a1 appears in SCOPe 2.07