Lineage for d3leka_ (3lek A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2385100Species Streptococcus mitis [TaxId:28037] [189586] (6 PDB entries)
  8. 2385105Domain d3leka_: 3lek A: [180228]
    automated match to d1k12a_
    complexed with bcw, ca, ni

Details for d3leka_

PDB Entry: 3lek (more details), 2 Å

PDB Description: lectin domain of lectinolysin complexed with lewis b antigen
PDB Compounds: (A:) Platelet aggregation factor Sm-hPAF

SCOPe Domain Sequences for d3leka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3leka_ b.18.1.0 (A:) automated matches {Streptococcus mitis [TaxId: 28037]}
veteniargkqasqsstayggaatravdgnvdsdyghhsvthtnfednawwqvdlgkten
vgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdaryvk
velktkntplslaevevfrsa

SCOPe Domain Coordinates for d3leka_:

Click to download the PDB-style file with coordinates for d3leka_.
(The format of our PDB-style files is described here.)

Timeline for d3leka_: