| Class b: All beta proteins [48724] (174 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (6 species) not a true protein |
| Species Streptococcus mitis [TaxId:28037] [189586] (4 PDB entries) |
| Domain d3leka_: 3lek A: [180228] automated match to d1k12a_ complexed with bcw, ca, ni |
PDB Entry: 3lek (more details), 2 Å
SCOPe Domain Sequences for d3leka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3leka_ b.18.1.0 (A:) automated matches {Streptococcus mitis [TaxId: 28037]}
veteniargkqasqsstayggaatravdgnvdsdyghhsvthtnfednawwqvdlgkten
vgkvklynrgdgnvanrlsnfdvvllneakqevarqhfdslngkaelevfftakdaryvk
velktkntplslaevevfrsa
Timeline for d3leka_: