Lineage for d3leab_ (3lea B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570794Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
    automatically mapped to Pfam PF13574
    automatically mapped to Pfam PF13583
  6. 2570795Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)
  7. 2570796Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries)
  8. 2570814Domain d3leab_: 3lea B: [180224]
    automated match to d1bkce_
    complexed with ipa, z93, zn

Details for d3leab_

PDB Entry: 3lea (more details), 2 Å

PDB Description: crystal structure of the catalytic domain of tace with isoindolinone- biphenyl-hydantoin inhibitor
PDB Compounds: (B:) Disintegrin and metalloproteinase domain-containing protein 17

SCOPe Domain Sequences for d3leab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3leab_ d.92.1.10 (B:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
radpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkg
ygiqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvcl
ahlftyqdfdmgtlglayggspranshggvcpkayyspvgkkniylnsgltstknygkti
ltkeadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcs
kqsiyktieskaqecfqersn

SCOPe Domain Coordinates for d3leab_:

Click to download the PDB-style file with coordinates for d3leab_.
(The format of our PDB-style files is described here.)

Timeline for d3leab_: