SCOPe 2.08: Domain d3leab_: 3lea B:

Lineage for d3leab_ (3lea B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
   automatically mapped to Pfam PF13574
   automatically mapped to Pfam PF13583

6. Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries)

8. Domain d3leab_: 3lea B: [180224]
   automated match to d1bkce_
   complexed with ipa, z93, zn

Details for d3leab_

PDB Entry: 3lea, 2 Å

PDB Description: crystal structure of the catalytic domain of tace with isoindolinone- biphenyl-hydantoin inhibitor

PDB Compounds: (B:) Disintegrin and metalloproteinase domain-containing protein 17

SCOPe Domain Sequences for d3leab_:

Sequence; same for both SEQRES and ATOM records:

>d3leab_ d.92.1.10 (B:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
radpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkg
ygiqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvcl
ahlftyqdfdmgtlglayggspranshggvcpkayyspvgkkniylnsgltstknygkti
ltkeadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcs
kqsiyktieskaqecfqersn

Timeline for d3leab_:

• d3leab_ first appeared in SCOPe 2.01
  
• d3leab_ appears in SCOPe 2.07