Lineage for d3le5a_ (3le5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2966008Family d.94.1.0: automated matches [191653] (1 protein)
    not a true family
  6. 2966009Protein automated matches [191210] (2 species)
    not a true protein
  7. 2966014Species Thermoanaerobacter tengcongensis [TaxId:273068] [189569] (5 PDB entries)
  8. 2966023Domain d3le5a_: 3le5 A: [180214]
    automated match to d1mo1a_

Details for d3le5a_

PDB Entry: 3le5 (more details), 2 Å

PDB Description: Crystal structure of HPr dimer from Thermoanaerobacter tengcongensis
PDB Compounds: (A:) Phosphotransferase system, HPr-related proteins

SCOPe Domain Sequences for d3le5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3le5a_ d.94.1.0 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
vklsaegddeeeaikalvdlieskfge

SCOPe Domain Coordinates for d3le5a_:

Click to download the PDB-style file with coordinates for d3le5a_.
(The format of our PDB-style files is described here.)

Timeline for d3le5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3le5b_