SCOPe 2.08: Domain d3le1b_: 3le1 B:

Lineage for d3le1b_ (3le1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.0: automated matches [191653] (1 protein)
   not a true family

6. Protein automated matches [191210] (2 species)
   not a true protein

7. Species Thermoanaerobacter tengcongensis [TaxId:273068] [189569] (5 PDB entries)

8. Domain d3le1b_: 3le1 B: [180209]
   automated match to d1k1ca_
   complexed with cd

Details for d3le1b_

PDB Entry: 3le1, 1.51 Å

PDB Description: Crystal structure of apoHPr monomer from Thermoanaerobacter tengcongensis

PDB Compounds: (B:) Phosphotransferase system, HPr-related proteins

SCOPe Domain Sequences for d3le1b_:

Sequence; same for both SEQRES and ATOM records:

>d3le1b_ d.94.1.0 (B:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
vklsaegddeeeaikalvdlieskf

Timeline for d3le1b_:

• d3le1b_ first appeared in SCOPe 2.01
  
• d3le1b_ appears in SCOPe 2.07