| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
| Family d.94.1.0: automated matches [191653] (1 protein) not a true family |
| Protein automated matches [191210] (2 species) not a true protein |
| Species Thermoanaerobacter tengcongensis [TaxId:273068] [189569] (5 PDB entries) |
| Domain d3le1a_: 3le1 A: [180208] automated match to d1k1ca_ complexed with cd |
PDB Entry: 3le1 (more details), 1.51 Å
SCOPe Domain Sequences for d3le1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3le1a_ d.94.1.0 (A:) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}
mkevtieiknktglharpaalfvqtaskfssqiwvekdnkkvnaksimgimslgvsqgnv
vklsaegddeeeaikalvdlieskfge
Timeline for d3le1a_: