SCOPe 2.07: Domain d3ldzd_: 3ldz D:

Lineage for d3ldzd_ (3ldz D:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.0: automated matches [191620] (1 protein)
   not a true family

6. Protein automated matches [191137] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries)

8. Domain d3ldzd_: 3ldz D: [180203]
   Other proteins in same PDB: d3ldze_, d3ldzf_, d3ldzg_
   automated match to d1elka_

Details for d3ldzd_

PDB Entry: 3ldz, 2.6 Å

PDB Description: crystal structure of human stam1 vhs domain in complex with ubiquitin

PDB Compounds: (D:) Signal transducing adapter molecule 1

SCOPe Domain Sequences for d3ldzd_:

Sequence; same for both SEQRES and ATOM records:

>d3ldzd_ a.118.9.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fatnpfdqdvekatsemntaedwglildicdkvgqsrtgpkdclrsimrrvnhkdphvam
qaltllgacvsncgkifhlevcsrdfasevsnvlnkghpkvceklkalmvewtdefkndp
qlslisamiknlkeqgvtfp

Timeline for d3ldzd_:

• d3ldzd_ first appeared in SCOPe 2.01
  
• d3ldzd_ appears in SCOPe 2.06
  
• d3ldzd_ appears in the current release, SCOPe 2.08