Lineage for d3ldzd_ (3ldz D:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096456Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 1096539Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 1096540Protein automated matches [191137] (1 species)
    not a true protein
  7. 1096541Species Human (Homo sapiens) [TaxId:9606] [189251] (1 PDB entry)
  8. 1096545Domain d3ldzd_: 3ldz D: [180203]
    Other proteins in same PDB: d3ldze_, d3ldzf_, d3ldzg_
    automated match to d1elka_

Details for d3ldzd_

PDB Entry: 3ldz (more details)

PDB Description: crystal structure of human stam1 vhs domain in complex with ubiquitin
PDB Compounds: (D:) Signal transducing adapter molecule 1

SCOPe Domain Sequences for d3ldzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldzd_ a.118.9.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fatnpfdqdvekatsemntaedwglildicdkvgqsrtgpkdclrsimrrvnhkdphvam
qaltllgacvsncgkifhlevcsrdfasevsnvlnkghpkvceklkalmvewtdefkndp
qlslisamiknlkeqgvtfp

SCOPe Domain Coordinates for d3ldzd_:

Click to download the PDB-style file with coordinates for d3ldzd_.
(The format of our PDB-style files is described here.)

Timeline for d3ldzd_: