SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ldzd_ (3ldz D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007623Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2007726Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2007727Protein automated matches [191137] (4 species)
    not a true protein
  7. 2007730Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries)
  8. 2007741Domain d3ldzd_: 3ldz D: [180203]
    Other proteins in same PDB: d3ldze_, d3ldzf_, d3ldzg_
    automated match to d1elka_

Details for d3ldzd_

PDB Entry: 3ldz (more details)

PDB Description: Crystal structure of human STAM1 VHS domain in complex with ubiquitin
PDB Compounds: (D:) Signal transducing adapter molecule 1

SCOPe Domain Sequences for d3ldzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldzd_ a.118.9.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fatnpfdqdvekatsemntaedwglildicdkvgqsrtgpkdclrsimrrvnhkdphvam
qaltllgacvsncgkifhlevcsrdfasevsnvlnkghpkvceklkalmvewtdefkndp
qlslisamiknlkeqgvtfp

SCOPe Domain Coordinates for d3ldzd_:

Click to download the PDB-style file with coordinates for d3ldzd_.
(The format of our PDB-style files is described here.)

Timeline for d3ldzd_: