Lineage for d3ldzc_ (3ldz C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727055Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2727164Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2727165Protein automated matches [191137] (5 species)
    not a true protein
  7. 2727176Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries)
  8. 2727182Domain d3ldzc_: 3ldz C: [180202]
    Other proteins in same PDB: d3ldze_, d3ldzf_, d3ldzg_
    automated match to d1elka_

Details for d3ldzc_

PDB Entry: 3ldz (more details), 2.6 Å

PDB Description: crystal structure of human stam1 vhs domain in complex with ubiquitin
PDB Compounds: (C:) Signal transducing adapter molecule 1

SCOPe Domain Sequences for d3ldzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldzc_ a.118.9.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fatnpfdqdvekatsemntaedwglildicdkvgqsrtgpkdclrsimrrvnhkdphvam
qaltllgacvsncgkifhlevcsrdfasevsnvlnkghpkvceklkalmvewtdefkndp
qlslisamiknlkeqgvtfp

SCOPe Domain Coordinates for d3ldzc_:

Click to download the PDB-style file with coordinates for d3ldzc_.
(The format of our PDB-style files is described here.)

Timeline for d3ldzc_: