Lineage for d3ldzb_ (3ldz B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010991Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2011100Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 2011101Protein automated matches [191137] (5 species)
    not a true protein
  7. 2011106Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries)
  8. 2011115Domain d3ldzb_: 3ldz B: [180201]
    Other proteins in same PDB: d3ldze_, d3ldzf_, d3ldzg_
    automated match to d1elka_

Details for d3ldzb_

PDB Entry: 3ldz (more details)

PDB Description: crystal structure of human stam1 vhs domain in complex with ubiquitin
PDB Compounds: (B:) Signal transducing adapter molecule 1

SCOPe Domain Sequences for d3ldzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldzb_ a.118.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fatnpfdqdvekatsemntaedwglildicdkvgqsrtgpkdclrsimrrvnhkdphvam
qaltllgacvsncgkifhlevcsrdfasevsnvlnkghpkvceklkalmvewtdefkndp
qlslisamiknlkeqgvtfp

SCOPe Domain Coordinates for d3ldzb_:

Click to download the PDB-style file with coordinates for d3ldzb_.
(The format of our PDB-style files is described here.)

Timeline for d3ldzb_: