| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
| Family a.118.9.0: automated matches [191620] (1 protein) not a true family |
| Protein automated matches [191137] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries) |
| Domain d3ldzb_: 3ldz B: [180201] Other proteins in same PDB: d3ldze_, d3ldzf_, d3ldzg_ automated match to d1elka_ |
PDB Entry: 3ldz (more details), 2.6 Å
SCOPe Domain Sequences for d3ldzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ldzb_ a.118.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fatnpfdqdvekatsemntaedwglildicdkvgqsrtgpkdclrsimrrvnhkdphvam
qaltllgacvsncgkifhlevcsrdfasevsnvlnkghpkvceklkalmvewtdefkndp
qlslisamiknlkeqgvtfp
Timeline for d3ldzb_: