Lineage for d3ldmb_ (3ldm B:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962426Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1962427Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1962428Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 1962465Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 1962466Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 1962570Domain d3ldmb_: 3ldm B: [180195]
    automated match to d1bpia_

Details for d3ldmb_

PDB Entry: 3ldm (more details), 2.6 Å

PDB Description: Crystal structure of aprotinin in complex with sucrose octasulfate: unusual interactions and implication for heparin binding
PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3ldmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ldmb_ g.8.1.1 (B:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOPe Domain Coordinates for d3ldmb_:

Click to download the PDB-style file with coordinates for d3ldmb_.
(The format of our PDB-style files is described here.)

Timeline for d3ldmb_: