Lineage for d3lc5a_ (3lc5 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2064641Protein Coagulation factor IXa, protease domain [50583] (2 species)
  7. 2064642Species Human (Homo sapiens) [TaxId:9606] [50585] (16 PDB entries)
  8. 2064658Domain d3lc5a_: 3lc5 A: [180175]
    Other proteins in same PDB: d3lc5b_
    automated match to d1rfna_
    complexed with ca, izx

Details for d3lc5a_

PDB Entry: 3lc5 (more details), 2.62 Å

PDB Description: Selective Benzothiophine Inhibitors of Factor IXa
PDB Compounds: (A:) coagulation factor ix

SCOPe Domain Sequences for d3lc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lc5a_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d3lc5a_:

Click to download the PDB-style file with coordinates for d3lc5a_.
(The format of our PDB-style files is described here.)

Timeline for d3lc5a_: