SCOPe 2.07: Domain d3lbza_: 3lbz A:

Lineage for d3lbza_ (3lbz A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (33 PDB entries)

8. Domain d3lbza_: 3lbz A: [180169]
   automated match to d1r2ba_
   complexed with z88, z89

Details for d3lbza_

PDB Entry: 3lbz, 2.3 Å

PDB Description: crystal structure of the bcl6 btb domain complexed with the small molecule inhibitor 79-6

PDB Compounds: (A:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d3lbza_:

Sequence; same for both SEQRES and ATOM records:

>d3lbza_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as

Timeline for d3lbza_:

• d3lbza_ first appeared in SCOPe 2.01
  
• d3lbza_ appears in SCOPe 2.06
  
• d3lbza_ appears in the current release, SCOPe 2.08