Lineage for d3lble_ (3lbl E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321461Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2321462Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2321463Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2321470Protein MDM2 [47594] (2 species)
  7. 2321488Species Human (Homo sapiens) [TaxId:9606] [47596] (69 PDB entries)
  8. 2321506Domain d3lble_: 3lbl E: [180166]
    Other proteins in same PDB: d3lbla2
    automated match to d1rv1a_
    complexed with mi6

Details for d3lble_

PDB Entry: 3lbl (more details), 1.6 Å

PDB Description: structure of human mdm2 protein in complex with mi-63-analog
PDB Compounds: (E:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d3lble_:

Sequence, based on SEQRES records: (download)

>d3lble_ a.42.1.1 (E:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycs
ndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Sequence, based on observed residues (ATOM records): (download)

>d3lble_ a.42.1.1 (E:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
ipaseqetlvrpkplllkllksvkdtytmkevlfylgqyimtkrlyqhivycsndllgdl
fgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d3lble_:

Click to download the PDB-style file with coordinates for d3lble_.
(The format of our PDB-style files is described here.)

Timeline for d3lble_: