SCOPe 2.08: Domain d3lbla1: 3lbl A:18-110

Lineage for d3lbla1 (3lbl A:18-110)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)

8. Domain d3lbla1: 3lbl A:18-110 [180164]
   Other proteins in same PDB: d3lbla2
   automated match to d1rv1a_
   complexed with mi6

Details for d3lbla1

PDB Entry: 3lbl, 1.6 Å

PDB Description: structure of human mdm2 protein in complex with mi-63-analog

PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d3lbla1:

Sequence; same for both SEQRES and ATOM records:

>d3lbla1 a.42.1.1 (A:18-110) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d3lbla1:

• d3lbla1 first appeared in SCOPe 2.01, called d3lbla_
  
• d3lbla1 appears in SCOPe 2.07