Class a: All alpha proteins [46456] (290 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) binds to the transactivation domain of human p53 |
Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
Protein MDM2 [47594] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries) |
Domain d3lbla1: 3lbl A:18-110 [180164] Other proteins in same PDB: d3lbla2 automated match to d1rv1a_ complexed with mi6 |
PDB Entry: 3lbl (more details), 1.6 Å
SCOPe Domain Sequences for d3lbla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lbla1 a.42.1.1 (A:18-110) MDM2 {Human (Homo sapiens) [TaxId: 9606]} qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc sndllgdlfgvpsfsvkehrkiytmiyrnlvvv
Timeline for d3lbla1: