| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) ![]() binds to the transactivation domain of human p53 |
| Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins) Pfam PF02201 |
| Protein MDM2 [47594] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries) |
| Domain d3lbka_: 3lbk A: [180163] automated match to d1rv1a_ complexed with k23, so4 |
PDB Entry: 3lbk (more details), 2.3 Å
SCOPe Domain Sequences for d3lbka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lbka_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
tlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
fgvpsfsvkehrkiytmiyrnlvvv
Timeline for d3lbka_: