Lineage for d3lb4b_ (3lb4 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686003Protein Dehaloperoxidase [46530] (1 species)
  7. 2686004Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)
  8. 2686044Domain d3lb4b_: 3lb4 B: [180157]
    automated match to d1ew6a_
    complexed with fpn, hem, so4

Details for d3lb4b_

PDB Entry: 3lb4 (more details), 1.56 Å

PDB Description: Two-site competitive inhibition in dehaloperoxidase-hemoglobin
PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d3lb4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lb4b_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3lb4b_:

Click to download the PDB-style file with coordinates for d3lb4b_.
(The format of our PDB-style files is described here.)

Timeline for d3lb4b_: