Lineage for d3lawe_ (3law E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868576Domain d3lawe_: 3law E: [180149]
    automated match to d1vg0b_
    complexed with gnp, mg; mutant

Details for d3lawe_

PDB Entry: 3law (more details), 2.8 Å

PDB Description: structure of gtp-bound l129f mutant rab7
PDB Compounds: (E:) Ras-related protein Rab-7a

SCOPe Domain Sequences for d3lawe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lawe_ c.37.1.8 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdta
gqerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgn
kidfenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalkqetev

SCOPe Domain Coordinates for d3lawe_:

Click to download the PDB-style file with coordinates for d3lawe_.
(The format of our PDB-style files is described here.)

Timeline for d3lawe_: