SCOPe 2.05: Domain d3lasb_: 3las B:

Lineage for d3lasb_ (3las B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (7 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [189597] (1 PDB entry)

8. Domain d3lasb_: 3las B: [180144]
   automated match to d1g5ca_
   complexed with gai, gol, mg, zn

Details for d3lasb_

PDB Entry: 3las, 1.4 Å

PDB Description: Crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution

PDB Compounds: (B:) Putative carbonic anhydrase

SCOPe Domain Sequences for d3lasb_:

Sequence; same for both SEQRES and ATOM records:

>d3lasb_ c.53.2.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
mvmsyfdnfikanqayvdlhgtahlplkpktrvaivtcmdsrlhvapalglalgdahilr
naggrvtddvirslviseqqlgtseivvlhhtdcgaqtftnaefteqlkrdlavdagdqd
flpftdieesvrediallknsplipediiisgaiydvdtgrvrevn

Timeline for d3lasb_:

• d3lasb_ first appeared in SCOPe 2.01
  
• d3lasb_ appears in SCOPe 2.04
  
• d3lasb_ appears in SCOPe 2.06
  
• d3lasb_ appears in the current release, SCOPe 2.08