SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3lasb_ (3las B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121765Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2121810Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2121928Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2121929Protein automated matches [190830] (9 species)
    not a true protein
  7. 2121984Species Streptococcus mutans [TaxId:1309] [189597] (1 PDB entry)
  8. 2121986Domain d3lasb_: 3las B: [180144]
    automated match to d1g5ca_
    complexed with gai, gol, mg, zn

Details for d3lasb_

PDB Entry: 3las (more details), 1.4 Å

PDB Description: Crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution
PDB Compounds: (B:) Putative carbonic anhydrase

SCOPe Domain Sequences for d3lasb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lasb_ c.53.2.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
mvmsyfdnfikanqayvdlhgtahlplkpktrvaivtcmdsrlhvapalglalgdahilr
naggrvtddvirslviseqqlgtseivvlhhtdcgaqtftnaefteqlkrdlavdagdqd
flpftdieesvrediallknsplipediiisgaiydvdtgrvrevn

SCOPe Domain Coordinates for d3lasb_:

Click to download the PDB-style file with coordinates for d3lasb_.
(The format of our PDB-style files is described here.)

Timeline for d3lasb_: