Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (107 species) not a true protein |
Species Salmonella enterica [TaxId:216597] [189263] (2 PDB entries) |
Domain d3l9vd_: 3l9v D: [180132] automated match to d1acva_ complexed with p4c, p6g, pe8 |
PDB Entry: 3l9v (more details), 2.15 Å
SCOPe Domain Sequences for d3l9vd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l9vd_ c.47.1.0 (D:) automated matches {Salmonella enterica [TaxId: 216597]} ewesitppvvdapavveffsfycppcyafsqtmgvdqairhvlpqgsrmvkyhvsllgpl gheltrawalamvmketdviekafftagmvekrlhspddvrrvfmsatgisrgeydrsik spavndmvalqerlfkeygvrgtpsvyvrgryhinnaafgafsvenfrsryaavvrklla g
Timeline for d3l9vd_:
View in 3D Domains from other chains: (mouse over for more information) d3l9va_, d3l9vb_, d3l9vc_, d3l9ve_ |