Lineage for d3l9va_ (3l9v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880248Species Salmonella enterica [TaxId:216597] [189263] (2 PDB entries)
  8. 2880250Domain d3l9va_: 3l9v A: [180129]
    automated match to d1acva_
    complexed with p4c, p6g, pe8

Details for d3l9va_

PDB Entry: 3l9v (more details), 2.15 Å

PDB Description: crystal structure of salmonella enterica serovar typhimurium srga
PDB Compounds: (A:) Putative thiol-disulfide isomerase or thioredoxin

SCOPe Domain Sequences for d3l9va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9va_ c.47.1.0 (A:) automated matches {Salmonella enterica [TaxId: 216597]}
aewesitppvvdapavveffsfycppcyafsqtmgvdqairhvlpqgsrmvkyhvsllgp
lgheltrawalamvmketdviekafftagmvekrlhspddvrrvfmsatgisrgeydrsi
kspavndmvalqerlfkeygvrgtpsvyvrgryhinnaafgafsvenfrsryaavvrkll
ag

SCOPe Domain Coordinates for d3l9va_:

Click to download the PDB-style file with coordinates for d3l9va_.
(The format of our PDB-style files is described here.)

Timeline for d3l9va_: