Lineage for d3l9sa_ (3l9s A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878773Protein automated matches [190208] (8 species)
    not a true protein
  7. 2878809Species Salmonella enterica [TaxId:216597] [189264] (1 PDB entry)
  8. 2878810Domain d3l9sa_: 3l9s A: [180127]
    automated match to d1a23a_

Details for d3l9sa_

PDB Entry: 3l9s (more details), 1.58 Å

PDB Description: crystal structure of salmonella enterica serovar typhimurium dsba
PDB Compounds: (A:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d3l9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9sa_ c.47.1.13 (A:) automated matches {Salmonella enterica [TaxId: 216597]}
isdgkqyitldkpvagepqvleffsfycphcyqfeevlhvsdnvkkklpegtkmtkyhve
flgplgkeltqawavamalgvedkvtvplfeavqktqtvqsaadirkvfvdagvkgedyd
aawnsfvvkslvaqqekaaadlqlqgvpamfvngkyqinpqgmdtssmdvfvqqyadtvk
ylvdk

SCOPe Domain Coordinates for d3l9sa_:

Click to download the PDB-style file with coordinates for d3l9sa_.
(The format of our PDB-style files is described here.)

Timeline for d3l9sa_: