Lineage for d3l9rh_ (3l9r H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2745642Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries)
  8. 2745647Domain d3l9rh_: 3l9r H: [180126]
    Other proteins in same PDB: d3l9ra1, d3l9ra2, d3l9ra3, d3l9rc1, d3l9rc2, d3l9rc3, d3l9re1, d3l9re2, d3l9re3, d3l9rg1, d3l9rg2, d3l9rg3
    automated match to d1bmga_
    complexed with cl, gol, l9q, l9r, nag

Details for d3l9rh_

PDB Entry: 3l9r (more details), 2.3 Å

PDB Description: crystal structure of bovine cd1b3 with endogenously bound ligands
PDB Compounds: (H:) Beta-2-microglobulin

SCOPe Domain Sequences for d3l9rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9rh_ b.1.1.2 (H:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl

SCOPe Domain Coordinates for d3l9rh_:

Click to download the PDB-style file with coordinates for d3l9rh_.
(The format of our PDB-style files is described here.)

Timeline for d3l9rh_: