SCOPe 2.01: Domain d3l9rf_: 3l9r F:

Lineage for d3l9rf_ (3l9r F:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48946] (3 PDB entries)

8. Domain d3l9rf_: 3l9r F: [180125]
   automated match to d1bmga_
   complexed with cl, gol, l9q, l9r, nag

Details for d3l9rf_

PDB Entry: 3l9r, 2.3 Å

PDB Description: crystal structure of bovine cd1b3 with endogenously bound ligands

PDB Compounds: (F:) Beta-2-microglobulin

SCOPe Domain Sequences for d3l9rf_:

Sequence; same for both SEQRES and ATOM records:

>d3l9rf_ b.1.1.2 (F:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl

Timeline for d3l9rf_:

• d3l9rf_ is new in SCOPe 2.01-stable
  
• d3l9rf_ appears in SCOPe 2.02
  
• d3l9rf_ appears in the current release, SCOPe 2.08