Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [48946] (6 PDB entries) |
Domain d3l9rb_: 3l9r B: [180123] Other proteins in same PDB: d3l9ra1, d3l9ra2, d3l9rc1, d3l9rc2, d3l9re1, d3l9re2, d3l9rg1, d3l9rg2 automated match to d1bmga_ complexed with cl, gol, l9q, l9r, nag |
PDB Entry: 3l9r (more details), 2.3 Å
SCOPe Domain Sequences for d3l9rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l9rb_ b.1.1.2 (B:) beta2-microglobulin {Cow (Bos taurus) [TaxId: 9913]} iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws fyllshaeftpnskdqyscrvkhvtleqprivkwdrd
Timeline for d3l9rb_: