SCOPe 2.01: Domain d3l9mb_: 3l9m B:

Lineage for d3l9mb_ (3l9m B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Pig (Sus scrofa) [TaxId:9823] [56117] (9 PDB entries)

8. Domain d3l9mb_: 3l9m B: [180121]
   automated match to d1cmke_
   complexed with l9m; mutant

Details for d3l9mb_

PDB Entry: 3l9m, 1.9 Å

PDB Description: Crystal structure of PKAB3 (pka triple mutant V123A, L173M, Q181K) with compound 18

PDB Compounds: (B:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d3l9mb_:

Sequence; same for both SEQRES and ATOM records:

>d3l9mb_ d.144.1.7 (B:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa) [TaxId: 9823]}
esvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamk
ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyapggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyikvtdfgfakrvk
grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d3l9mb_:

• d3l9mb_ is new in SCOPe 2.01-stable
  
• d3l9mb_ appears in SCOPe 2.02
  
• d3l9mb_ appears in the current release, SCOPe 2.08